<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
	<id>https://wiki.bioinfo.nat.tu-bs.de/history/FASTA-Format?feed=atom</id>
	<title>FASTA-Format - Revision history</title>
	<link rel="self" type="application/atom+xml" href="https://wiki.bioinfo.nat.tu-bs.de/history/FASTA-Format?feed=atom"/>
	<link rel="alternate" type="text/html" href="https://wiki.bioinfo.nat.tu-bs.de/history/FASTA-Format"/>
	<updated>2026-09-07T17:26:01Z</updated>
	<subtitle>Revision history for this page on the wiki</subtitle>
	<generator>MediaWiki 1.39.7</generator>
	<entry>
		<id>https://wiki.bioinfo.nat.tu-bs.de/index.php?title=FASTA-Format&amp;diff=164&amp;oldid=prev</id>
		<title>Vero: Created page with &quot;Das FASTA-Format ist ein textbasiertes Format zur Darstellung und Speicherung von Nukleotidsequenzen einer DNA, z.B. nach einer RNASeq. &lt;br&gt;  {| class=&quot;wikitable&quot; ! colspan=&quot;3...&quot;</title>
		<link rel="alternate" type="text/html" href="https://wiki.bioinfo.nat.tu-bs.de/index.php?title=FASTA-Format&amp;diff=164&amp;oldid=prev"/>
		<updated>2019-06-06T13:59:47Z</updated>

		<summary type="html">&lt;p&gt;Created page with &amp;quot;Das FASTA-Format ist ein textbasiertes Format zur Darstellung und Speicherung von Nukleotidsequenzen einer DNA, z.B. nach einer RNASeq. &amp;lt;br&amp;gt;  {| class=&amp;quot;wikitable&amp;quot; ! colspan=&amp;quot;3...&amp;quot;&lt;/p&gt;
&lt;p&gt;&lt;b&gt;New page&lt;/b&gt;&lt;/p&gt;&lt;div&gt;Das FASTA-Format ist ein textbasiertes Format zur Darstellung und Speicherung von Nukleotidsequenzen einer DNA, z.B. nach einer RNASeq. &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
{| class=&amp;quot;wikitable&amp;quot;&lt;br /&gt;
! colspan=&amp;quot;3&amp;quot;| Aufbau FASTA-Format&lt;br /&gt;
|-&lt;br /&gt;
| '''Kopfzeile''' ||Bacillus subtilis | &amp;lt;span style=&amp;quot;color:#FF0000&amp;quot;&amp;gt; &amp;gt; &amp;lt;/span&amp;gt;OpuC | Bacillus subtilis | Probe xy&lt;br /&gt;
|-&lt;br /&gt;
| '''Kommentar'''  || &amp;lt;span style=&amp;quot;color:#FF0000&amp;quot;&amp;gt; ; &amp;lt;/span&amp;gt;Optionaler Kommentar&lt;br /&gt;
|-&lt;br /&gt;
| '''Sequenz''' || MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLG KAAKKADRLAAEGLVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYK ALVAELEKENEERRRLKDPNKPEHKIPQFASRKQLSDAILKEAEEKIKEE LKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTLMGQFYVMDDKKTVE QVIAEKEKEFGGKIKIVEFICFEVGEGEVAAQLFDKAVQLLREKGLG &lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
*Die Kopfzeile ist die Sequenz-ID und beginnt mit einem '''&amp;gt;''', ohne Leerzeile startet der Text. Dabei handelt es sich um eine genaue Beschreibung der Sequenz, um diese von den anderen Sequenzen unterscheiden zu können.  &lt;br /&gt;
*Die Kommentarzeilen sind optional, dabei kann es eine, oder mehrere Kommentarzeilen geben, eingeleitet werden diese durch ein ''';''' (Semikolon).&lt;br /&gt;
*Nach den oben genannten Zeilen startet die Sequenz in 5' → 3' Richtung, entweder in Form von Nukleinbasen (AGCT), oder Aminosäuren-Codes. Lücken werden durch '''-''' dargestellt.&lt;/div&gt;</summary>
		<author><name>Vero</name></author>
	</entry>
</feed>